Anti-Munc-13 (cat) antibodies | |
Protein name(s) | Munc-13; Fragment; |
Gene name(s) | NULL |
Cross ref(s) | NULL |
Length | 94 AA |
AbClass™ | Crazy (learn more) |
Sequence | ILGNENRPGAYELHLSVKDYCFAREDRIIGMTVIRLQNISEKGSYGAWYPLLKNVSLDETGLTILRVLSQRTNDDVAKEFVRLKSETRSAEETA |
Antibodies available |
Each product listed below is a combination of individual monoclonal antibodies (mAbs) against a panel of synthetic peptide antigens from the corresponding region of the target protein. Each combination of mAbs is recommended to be used directly. Later, they can be deconvoluted (if necessary) as individual monoclonal antibodies after epitope determination for each single mAb. Epitope determination service is available at $100 per combination. |
X-Q8WMW4 -N | |
Description | A combination of mouse monoclonal antibodies against Q8WMW4 N terminus sequence |
Antigen information | 3 synthetic peptides representing the N terminus sequence |
Tested application | ELISA titer (antibody-antigen interaction): 10,000; approx. corresponding to 1 ng detection of target protein on WB |
X-Q8WMW4 -C | |
Description | A combination of mouse monoclonal antibodies against Q8WMW4 C terminus sequence |
Antigen information | 3 synthetic peptides representing the C terminus sequence |
Tested application | ELISA titer (antibody-antigen interaction): 10,000; approx. corresponding to 1 ng detection of target protein on WB |
X-Q8WMW4 -M | |
Description | A combination of mouse monoclonal antibodies against Q8WMW4 M terminus sequence |
Antigen information | 3 synthetic peptides representing the non-terminus sequence |
Tested application | ELISA titer (antibody-antigen interaction): 10,000; approx. corresponding to 1 ng detection of target protein on WB |
Purchase Options for Total Protein Detection |
Choose a recommended package covered by AbInsure™ program. | |||||
End-use | Recommended package | Price | Description | Availability | |
WB | X3 -Q8WMW4 | $ 1199 | AbInsure™ | Delivered in 30 days | |
3 antibody combinations included | |||||
X-Q8WMW4 - N | |||||
X-Q8WMW4 - C | |||||
X-Q8WMW4 - M |
Or choose a single combination (NOT covered by AbInsure™ program) | ||
Antibodies available | Price | Availability |
X-Q8WMW4 -N | $599 | Delivered in 30 days |
X-Q8WMW4 -C | $599 | Delivered in 30 days |
X-Q8WMW4 -M | $599 | Delivered in 30 days |
Or freely design a custom antibody development project (NOT covered by AbInsure™ program). |
We design and produce custom monoclonal antibodies tailored for your specific needs. If you cannot find antibodies you need from the above list, please don't hesitate to contact us for a free consultation. - Functional (blocking or neutrualizing) - Family cross-reactive or family distinguishing - Specific epitope(s) - Other special needs |
Any protein in cat
From $599
5 – 30 days to deliver
Find yours by protein name,
gene symbol or accession number