| Anti-Sp-LhH3b (purple sea urchin) antibodies | |
| Protein name(s) | Histone H3; |
| Gene name(s) | Sp-LhH3b; Sp-EhH3_1 Sp-EhH3_10 Sp-EhH3_14 Sp-EhH3_16 Sp-EhH3_18 Sp-EhH3_2 Sp-EhH3_22 Sp-EhH3_24 Sp-EhH3_25 Sp-EhH3_26 Sp-EhH3_27 Sp-EhH3_28 Sp-EhH3_29 Sp-EhH3_3 Sp-EhH3_30 Sp-EhH3_34 Sp-EhH3_35 Sp-EhH3_36 Sp-EhH3_37 Sp-EhH3_38 Sp-EhH3_41 Sp-EhH3_43 Sp-EhH皫?皬 |
| Cross ref(s) | XP_003724461.1;XP_003725435.1; |
| Length | 136 AA |
| AbClass™ | Crazy (learn more) |
| Sequence | MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTELRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA |
| Antibodies available |
|
Each product listed below is a combination of individual monoclonal antibodies (mAbs) against a panel of synthetic peptide antigens from the corresponding region of the target protein. Each combination of mAbs is recommended to be used directly. Later, they can be deconvoluted (if necessary) as individual monoclonal antibodies after epitope determination for each single mAb. Epitope determination service is available at $100 per combination. |
| X-H3I1F0 -N | |
| Description | A combination of mouse monoclonal antibodies against H3I1F0 N terminus sequence |
| Antigen information | 3 synthetic peptides representing the N terminus sequence |
| Tested application | ELISA titer (antibody-antigen interaction): 10,000; approx. corresponding to 1 ng detection of target protein on WB |
| X-H3I1F0 -C | |
| Description | A combination of mouse monoclonal antibodies against H3I1F0 C terminus sequence |
| Antigen information | 3 synthetic peptides representing the C terminus sequence |
| Tested application | ELISA titer (antibody-antigen interaction): 10,000; approx. corresponding to 1 ng detection of target protein on WB |
| X-H3I1F0 -M | |
| Description | A combination of mouse monoclonal antibodies against H3I1F0 M terminus sequence |
| Antigen information | 3 synthetic peptides representing the non-terminus sequence |
| Tested application | ELISA titer (antibody-antigen interaction): 10,000; approx. corresponding to 1 ng detection of target protein on WB |
| Purchase Options for Total Protein Detection |
| Choose a recommended package covered by AbInsure™ program. | |||||
| End-use | Recommended package | Price | Description | Availability | |
WB  |
X3 -H3I1F0 | $ 1199 | AbInsure™ | Delivered in 30 days | |
| 3 antibody combinations included | |||||
| X-H3I1F0 - N | |||||
| X-H3I1F0 - C | |||||
| X-H3I1F0 - M | |||||
| Or choose a single combination (NOT covered by AbInsure™ program) | ||
| Antibodies available | Price | Availability |
| X-H3I1F0 -N | $599 | Delivered in 30 days |
| X-H3I1F0 -C | $599 | Delivered in 30 days |
| X-H3I1F0 -M | $599 | Delivered in 30 days |
| Or freely design a custom antibody development project (NOT covered by AbInsure™ program). |
|
We design and produce custom monoclonal antibodies tailored for your specific needs. If you cannot find antibodies you need from the above list, please don't hesitate to contact us for a free consultation. - Functional (blocking or neutrualizing) - Family cross-reactive or family distinguishing - Specific epitope(s) - Other special needs |
Any protein in Strongylocentrotus purpuratus
From $599
5 – 30 days to deliver
Find yours by protein name,
gene symbol or accession number